KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLK
>CSRC_HUMAN KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLK( If the field 'Query label=' is blank, the label after '>' in the first line will be used as the label for the sequence. The character '>' in the sequence will terminate the sequence, and other non-alphabetical characters will be removed. )
Minimum length is 20 a.a.
|
PAPIA system,
papia@m.aist.go.jpCopyright © 1997-2000, Parallel Application TRC Lab. , RWCP , Japan Copyright © 2001, Computational Biology Research Center , AIST , Japan |